logoTmpPD
 
Du 13 10 2011 au 22 4 2012
Rencontres Pure Data au /TMP/LAB/ à la logogl
 
La Gaîté Lyrique : 3 bis rue Papin 75003 Paris Métro : Réaumur-Sébastopol
 
Le jeudi soir, dans l'espace "Centre de ressources" vers 19h00... Entrée libre.

S'inscrire à la mailing list: Tmplab mailing list

Pure Data (en abrégé pd) est un environnement de programmation graphique pour la création musicale et multimédia en temps réel. Free, OpenSource, pour Linux, MacOSX, Windows, iOS, Android...
 
Objectifs de ces rencontres
- Incitation à pratiquer ensemble
- Discussion, entraide
- Présentation de projets
- Initiation
 

PdTmpLab~1 Jeudi 13 10 2011

Participants:
 - Pascale Gustin pascsaq.org
 - Gerard Paresys gerard.paresys.free.fr
 - Jeff Guess  guess.fr  pratiques-algorithmiques.net
 - Pierre Mourles Concert accordéon, blackboxe au Théâtre de Verre, dimanche 16 10 2011
 - ...

Un synthétiseur vocal:
l'objet Pure Data external: mbrola~ de Nicolas d'Alessandro pour MacOSX

"Ce serait certes une invention considérable, que celle d'une machine capable de reproduire nos paroles, avec leurs sons et leurs articulations. Je crois que la chose n'est pas impossible."    Leonhard Euler, 1761

  Euler-fr4.mp3 (176Ko)
 
The MBROLA Project

"a diphone-based concatenative “phoneme-to-speech” synthesizer"
MBROLA = "Multi-Band Resynthesis OverLap Add"

Patches Pure Data (zip 28Mo)ExMM141b-Parole

One Of The First Vocoder Machine (Youtube)
Synthèse vocale (Wikipedia fr)
Speech synthesis (Wikipedia en)
Le projet MBROLA Article de T.DUTOIT & V.PAGEL en français
The MBROLA project Article de T.DUTOIT & V.PAGEL... en anglais
Les "Formant Brothers" (Youtube)

 
Problèmes
 - L'objet mbrola~ n'existe que pour MacOS
 - L'objet mbrola~ n'est pas inclus dans Pd-extended
 - Documentation ... ancienne
 - Mbrola est un logiciel "Phonemes to speech", il reste à trouver un logiciel "Text to Phonemes" transformant un fichier texte en fichier de phonèmes en notation SAMPA : un "pho-file" en entrée dans mbrola~
 - L'objet mbrola~ crash Pd s'il reçoit un message time ou pitch avant le chargement de la voice

 
...

 
 
 
PdTmpLab~2 Jeudi 20 10 2011

Franck -> Holophon -> Trajectoires sonores -> Objet earplug~ de Pd-extended
earplug "earplug~ is a realtime binaural filter based on KEMAR (Dummy-Head) impulse measurement. It allows you to spatialize a sound in realtime. It basically takes the KEMAR data set, and interpolates 366 locations where HRTF measurement exists in a spherical surface. you get azimuth control 0-360 and elevation -40 - 90." AUTHOR: Pei Xiang
 pdf Article de Pei Xiang, David Camargo, Miller Puckette


 
Objet Pd-extended quantize~ (library zexy de IOhannes m zmoelnig)
... Quantification 8 bits, 16 bits etc... écoute
 Quantification (signal) (Wikipedia)
 
 
 
Mini Malle
 
MiniMalle1 Présentation de la boîte de capteurs Mini Malle v1 de Pascale (Arduino "Duemilanove" et Pure Data).

La boîte intègre 6 capteurs et 6 leds de contrôle.
- 1 capteur de pression (FSR)
- 1 capteur de lumière (LDR)
- 1 potentiomètre 10Kohms
- 1 capteur de souffle (micro electret + amplification du signal)
- 1 capteur de choc (piézo + amplification du signal)
- 1 interrupteur reed switch

mini_malle (Projet sur gitorious) 
 
et ses patches Pure Datamillepatches_vue
 
 
Canon rythmique & Pavage numérique
 
-> patchExMM132-RhythmCanon
 
pdf Article A propos des canons rythmiques d'Emmanuel Amiot
pdf Article Asymmetric Rhythms and Tiling Canons de Rachel W. Hall et Paul Klingsberg
   Canon rythmique (Wikipedia)
 
 ... Sequencer -> Erwann -> Hydrogen drum machine
          Hydrogen  -> OSC -> Pd
          ou
          Hydrogen -> MIDI -> Pd      ? ... A voir
 
 
 
Patch Pure Data ExMM152-Motor
 
 
 
PdTmpLab~3 Jeudi 27 10 2011

Pure Data dans la main:
- Onyx Ashanti Beatjazz:
  Beatjazz Controller   Pd performance at TED
  3 x Arduino + 3 x XBee wireless + Wind controller + Capteur de force (FSR) + firmata/pduino soft + iPhone + Pure Data
  cardboard-isnt-humidity-proof"
 
- Marco Donnarumma:
  Xth Sense    Music for Flesh II  
  MMG (mechanomyogram) -> 2 x microphones + Accéléromètre + Pure Data + 8 canaux Audio
  pdf A Pd framework for the Xth Sense
  pdf Xth Sense: researching muscle sounds 
  
- Voir aussi: Michel Waisvisz:
  The Hands Performance
 
 
Référence capteur d'accélération
LIS331AL de STMicroelectronics
MEMS 3-axes ±2g sorties analogiques (3x3x1.0mm)
3.80 Euros HT chez Farnell
 
 
Les patches de la Mini Malle de Pascale -> voir: PdTmpLab~2
 
 
Développer en reliant graphiquement des objets
Pure data est un "Visual programming environment"
comme Max/MSP/Jitter ou LabView ou Lily 
 
 
Pure Data: 4 bouquins:
- The Theory and Technique of Electronic Music by Miller Puckette
- loadbang (Programming Electronic Music in Pd) de Johannes Kreidler
- Designing Sound by Andy Farnell / Obiwannabe
- FLOSS Manual in english et Floss Manual en français
 
 
Franck: à la recherche du fichier perdu
L'objet earplug~ (voir: PdTmpLab~2) ne fonctionne correctement que si le patch qui le contient et le fichier "earplug_data.txt" sont placés dans le même dossier.
Ce fichier est absent de Pd-0.42.5-extended sous MacOSX (Linux? Windows?).
On trouve "earplug_data.txt" dans: earplug~-0.2.tar.gz

 
Pavage musical rythmique régulier (en canon) 9 temps:
Possible? autre que:
  o||o||o||       ooo||||||          o|||oo|||
  |o||o||o|  ou   |||ooo|||   oui -> |||o|||oo
  ||o||o||o       ||||||ooo          |oo|||o||

          o|||oo|||o|||oo|||o|||oo|||
Ça donne: |||o|||oo|||o|||oo|||o|||oo etc..
          |oo|||o|||oo|||o|||oo|||o||
 
-> patchRhythmCanon9

  RhythmCanon9-1.mp3 (406Ko)
 
 
 
 
PdTmpLab~4 Jeudi 3 11 2011

Cyclone
La doc des objets de la library cyclone ("a library for porting and running Max/MSP patches in Pd") est dans la doc de Max/MSP:
http://www.cycling74.com/download/maxmsp46doc.zip

Par exemple curve~ dans MSP46ReferenceManual.pdf
Par exemple mousefilter dans Max46ReferenceManual.pdf


L'objet vline~


loadbang
KreidlerCov Trouvé au centre de ressources de la Gaîté Lyrique:
loadbang (Programming Electronic Music in Pd) de Johannes Kreidler


Impérialisme
Gland L'impérialisme américain a encore frappé: des glands de chêne d'Amérique (Quercus rubra) nous ont été gracieusement offerts par Philippe.
"Introduit en Europe dès 1724 ... son utilisation en forêt est de plus en plus déconseillée en Europe, car il produit de nombreux glands dès l'âge de 20 ans et peut se montrer envahissant et se substituer aux chênes autochtones." Wikipedia


Code
Pall Thayer code-based artworks
"Need info? Look at the code. Copyright? Copywrong? Copymaybe."


Dérive
François Le Lionnais -> Algol -> Poèmes ALGOL -> Perl Poetry

 
 
 
 
PdTmpLab~5 Jeudi 10 11 2011

GEM
Dessiner IR Le mode "single buffer" de GEM.
 
Dessiner avec l'infrarouge émis par une télécommande de télévision vers une WebCam.

 
Carré
B-Squares: Modular Solar Powered Electrics. by Jordan McRae
An Open Hardware project
 
 
Lecteur carte Audio
ShieldMp3 MP3 Player Shield pour Arduino

Eau
How to Build a Hydrophone
 

Puzzle
sur Thingiverse Digital Designs for Physical Objects
 
 
Apéro
Pascale à Nantes à l'aperoCodeLab #12
 

A faire
des Gifs animés comme Olivier 
 
 
 
 
PdTmpLab~6 Jeudi 17 11 2011

Objets fiddle~ et bonk~
pour détecter (ou "suivre") la hauteur et l'enveloppe, l'attaque d'un son.
"fiddle~: pitch estimator and sinusoidal peak finder"
  "bonk~: attack detection and spectral envelope measurement"

2 articles:
pdf 1995 Puckette Score following using the sung voice
pdf 1998 Puckette Apel Zicarelli: Real-time audio analysis tools for Pd and MSP
 
sigmund~ ou fiddle~ ? discussion sur la pdlist
 
 
Découverte...                            (merci Pascale)
brinkmann-picture  Les patches Audio de Martin Brinkmann
 
 
Interaction visuel/sonore
PdTmpVisSnd
Patch de Pascale... A venir...
 
 
CVM (Center for Visual Music) Page de liens
 

 
Spectrogramme          ... encore la relation visuel/sonore
Spectrogram-ToutDevientRouge

Affichage d'un spectrogramme dans la fenêtre GEM.

Un patch (en chantier...) tissé à partir du patch spectrogram.pd de William Brent    Désolé pour Mac ou Windows seulement.
Je n'arrive pas à compiler les objets à partir des sources de Brent.
 
Spectrogram (Wikipedia) 

 
 
 
 
PdTmpLab~7 Jeudi 24 11 2011

XBee
Arduino-XBee-Pierre
Arduino sans fil   Arduino Pro Mini Guide   Xbee Shield   Pduino

5 potentiomètres     Arduino
        +        <->   Pro   <-> XBee <-- 2.4 GHz--> XBee <-> USB
    5 switches         Mini                30m

pour l'accordéon de Pierre
 
 
Record/Play Audio simultanés:   les objets tabwrite~  tabplay~  tabread~  tabread4~
 
patch-looper
 
 Pierre looper.pd
patch-record-play
 
Gerard Record-Play
SON_DEV-sept2011

Pascale SON_DEV-sept2011

Voir loadbang (Programming Electronic Music in Pd) 3.4 Sampling de Johannes Kreidler
 
 
Lire
Combat de Carnaval et Carême        (Pascale...)
Karneval-und-Fasten
"... Pure Data est à mon sens, très proche de l'écriture. D'une forme d'écriture graphique assez libre : de cette forme de liberté que je ressens à utiliser la langue, le langage. C'est comme si je pouvais faire la même chose sur le « canvas » blanc avec lequel je commence à travailler. Qu'importe parfois le résultat, le plaisir de l'écriture libre domine. Je ne cherche pas, je fais des trouvailles au fil des fils que j'entremêle les uns avec les autres, que je tends pour inscrire organiquement le fragment d'une idée, d'un son, d'un visuel, d'une interaction. Cela peut sembler ridicule de s'attacher à un outil, mais Pure Data est aussi un langage et un langage, quel qu'il soit, n'est pas seulement un outil. Une langue n'est pas seulement un outil pour parler : c'est aussi un affect, un vécu. Sinon, comment le sens des choses pourrait-il être mis à jour à l'intérieur des corps ? Comment les mots, les sons vocaux, l'ordonnancement des caractères sur la page d'un livre ou sur l'écran pourraient-ils avoir un quelconque impact sur notre affect ?"
 
 
 
 
 
PdTmpLab~8 Jeudi 1 12 2011

Conférence @/tmplab : Pall Thayer et ses Microcodes à 19h invité par Pascale
OnEverything
Pall Thayer est un artiste islandais / américain qui travaille le code de programmation comme un médium artistique.

Le code de programmation informatique a surtout été considéré pour son rôle fonctionnel. Alors même que les artistes ont déplacé leur pratique vers l'écriture du code pour produire des œuvres d'arts, le code lui-même est perçu comme un «outil» et n'est pas généralement considéré de manière significative pour son aspect esthétique ou conceptuel.
Pall Thayer présentera certaines de ses œuvres remontant à l'année 2006. Il utilisera sa pièce «On Everything» comme point de départ pour expliquer et examiner le rôle du code dans son travail et pourquoi il en est venu à produire ses «Microcodes», pièces entièrement basées sur l'affichage du code de programmation présenté comme travail artistique à part entière, par opposition à l'affichage du résultat de l'exécution de ce code.
Pall Thayer is an Icelandic/American artist who works with computer programming code as an artistic medium.

Computer programming code has mostly been regarded in a functional sense. Even as artists have moved into the realm of writing code to produce art, the code itself has been seen as a "tool" and not generally considered in an aesthetic or conceptually meaningful way. Pall Thayer will present some of his art work going back to the year 2006, using his piece «On Everything» as a point of departure to explain and examine the role of code in his work and why he later ended up producing "Microcodes", works based entirely on displaying computer programming code as final art works as opposed to displaying the results of running that code.

 
PitchShift = Transposition
Méthode 1 Voir Pd-0.42.5-extended -> Browser... -> /Pure Data/3.audio.examples/G09.pitchshift.pd
  Miller Puckette The Theory and Technique of Electronic Music p202 & 218
  ExMM98-PitchShift.zip
Méthode 2 avec l'objet soundtouch~ de Katja Vetter
  ExMM99-PitchShift2.zip
 
 
NoiseGate
    avec FFT  ExMM26-FFTNoiseGate.zip
 
 
Je me demande...
Palimpseste
après la conférence de Pall Thayer, je me demande s'il existe des palimpsestes en code informatique.
 
"Le palimpseste (du grec ancien παλίμψηστος / palímpsêstos, « gratté de nouveau ») est un manuscrit écrit sur un parchemin préalablement utilisé, et dont on a fait disparaître les inscriptions pour y écrire de nouveau. Cette méthode fut utilisée au Moyen Âge, surtout entre le viie siècle et le xiie siècle, par des copistes qui, le parchemin coûtant cher, réutilisaient d'anciens manuscrits pour y copier de nouveaux textes. Pour cela, les vieux manuscrits étaient préalablement désencrés ou effacés grâce à de la pierre ponce." (Wikipedia)

 
 
 
 
PdTmpLab~9 Jeudi 8 12 2011
 
Son "Point"
Franck... équivalent sonore d'un point... Un "Dirac"? ... Wikipedia
 
 
Dirac-Pd
 
  dirac.pd
+ simple!
dirac-simple-Pd
 
dirac-simple.pd

Voir Microsound Microsound de Curtis Roads:

Dirac-Curtis-roads

 
 
 
 
PdTmpLab~10 Jeudi 15 12 2011
 
Open-EEG & Pure Data
OpenEEG  &  ProjetEEG  A voir: openvibe
"OpenViBE is a software for real-time neurosciences (that is, for real-time processing of brain signals). It can be used to acquire, filter, process, classify and visualize brain signals in real time."
... utiliser OpenViBE pour traiter les fichiers Open-EEG créés par Pure Data?
 
Le hardware Open-EEG est compatible OpenViBE 
 
 
Ultra Lite
UltraLite 
Impossible d'utiliser l'interface FireWire Audio MOTU Ultra Lite sous Ubuntu?
Avec Pure Data ou autre chose...
 
 
Play
Urs -> le player Audio idéal sous Pure Data... reste à faire!
 
Un début? -> PlayerVarySpeed 
 
 
 
 
 
PdTmpLab~11 Jeudi 22 12 2011
   
Neural Network & Pure Data... David Tudor
Library ann de Davide Morelli, IOhannes m zmölnig et ArtificialNeuralNetworks et Fann
David Tudor Neural Synthesis No. 9.wmv ... The Neural Network Synthesizer Music Box 2
 
Shield Multiplexeur analogique pour Arduino
 
Contrôler en MIDI (messages "Control Change") le MM FreqShift (ARGOPd) -> larsen sur Mac ->
 -> LarsenMacBook.zipLarsenMacBook
 
Curtis Roads sur YouTube
 
Brian O'Reilly sur Vimeo
 
 
 
 
 
Pas de PdTmpLab les jeudis 29 12 2011 & 5 1 2012
 
12 1 2012: Conférence Cradle to Cradle au 7e étage
 
 
 
 
 
PdTmpLab~12 Jeudi 19 1 2012
 
MIDI/Audio sous Linux
Pure Data -> MIDI -> QSynth -> Audio -> Ecoute

en détaillant:
Pd-extended -> Alsa-MIDI -> MIDI -> QjackCtl -> Alsa -> MIDI -> QSynth + SoundFont -> Audio -> QjackCtl -> Ecoute

+ détaillé: pdf Config-MIDI-Linux2.pdf

ou:
RoseGarden -> MIDI -> QSynth -> Audio -> Ecoute
 
 
Markov & MIDIFile
Markov Chains in PureData de "ACUMA" sur le blog Algorithmi Ccomposer
 
-> patchExMM86a-MIDI-Markov
 
 
emotiv
Sam (EEG) -> emotiv epoc et Pure Data -> np_epoc
"np_epoc is an external for either Max/MSP or Puredata to receive information from the Emotiv EPOC EEG."
 ... A essayer...
 
 
 
 
 
PdTmpLab~13 Jeudi 26 1 2012
 
Markov encore
-> patchesExMM135c-Markov
 
 
Live Coding
Dérive -> (fluxus) ?
 
 
 
 
 
 
PdTmpLab~-12 Jeudi 2 2 2012
 
Spatialisation
-> patchesSpatial
 
A Voir -> Technique transaurale
 
 
Live-Coding -> Des liens
 
 
 
 
 
PdTmpLab~-11 Jeudi 9 2 2012
 
Audification-Sonification           (Franck Protéines La Paillasse....)
The Sonification Handbook
sonifyer.org
 
 
857clusters Pascale en résidence à Labomedia: Projet "857 clusters"
 
 
 
 
 
PdTmpLab~-10 Jeudi 16 2 2012
 
DMX (Sam)
Mac + Pure Data -> USB -> ENTECC-DMX-USB-PRO

Interface
ENTTEC DMX USB PRO
-> DMX -> Par56
Projecteur
Par56 151 LEDs
 
Installation de FTDIUSBSerialDriver_v2_2_16 dans le Mac (idem Driver pour Arduino)
Patch Pure Data Go2enttec.zip chez LaboMedia

Les bases du protocole DMX  (Audiofanzine)
 
 
PitchShift (Transposition) (Gabriel)
schaeffer.gif
Le phonogène universel de Pierre Schaeffer (1963).
 
"L’apport des techniques d’enregistrement dans la fabrication de matieres et de formes musicales nouvelles."   Jacques Poullin (1952 environ)
 
Voir plus haut PdTmpLab~8
... lire Pitch Shifting de Katja Vetter

 
Sam aux journées du PraTIC lundi prochain.
 
 
 
 
 
 
PdTmpLab~-9 Jeudi 23 2 2012

Protéine
269px-Protein_PRNP_PDB_1ag2
A partir d'un projet de Franck & Loïc
 
 
Sonification de la séquence d'acides aminés constituant une protéine.
Exemple de protéine: le prion humain.

On trouve la séquence des 253 acides aminés du "Prion (Homo sapiens)" (PrP) sur:
http://www.uniprot.org/uniprot/P04156 -> Isoform 1 ->
 
>sp|P04156|PRIO_HUMAN Major prion protein OS=Homo sapiens GN=PRNP PE=1 SV=1
MANLGCWMLVLFVATWSDLGLCKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQP
HGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHSQWNKPSKPKTNMKHMAGAAAAGA
VVGGLGGYMLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCV
NITIKQHTVTTTTKGENFTETDVKMMERVVEQMCITQYERESQAYYQRGSSMVLFSSPPV
ILLISFLIFLIVG
 
-> Fichier au format texte codé en UTF8 -> Prion.txt
 
Il existe 22 acides aminés différents notés: ACDEFGHIKLMNOPQRSTUVWY.
 
Rapide (et grossière) sonification de cette séquence en un patch Pure data: faire correspondre au code ASCII de chacune de ces 22 lettres majuscules le code MIDI de la hauteur des notes.
 
Lettre A -> Code ASCII = 65 -> Code MIDI Note = 65 -> Note F3
Lettre B -> Code ASCII = 66 -> Code MIDI Note = 66 -> Note F#3
...
Lettre Y -> Code ASCII = 89 -> Code MIDI Note = 89 -> Note F5
 
On obtient une mélodie de 253 notes.
Patch -> PatchTextSonification

  PatchTextSonification.mp3 (492Ko)
 
On peut entendre la répétition 4 fois de la séquence: GGGWGQPH.
 
Liens:  LaPaillasse  Broohaha  ExPASy  PyRx  
 
 
 
 
 
PdTmpLab~-8 Jeudi 1 3 2012


PdTmpLab~-7 Jeudi 8 3 2012

Kinect & Pd... voir -> Codelab & pd-kinect-skeleton
 
Wii & Pd... voir -> Wiilib & kishalmi.net & la malette Miam
 
Mortal Engine by Chunky Move ... Interactive System Designer: Frieder Weiss avec Eyecon pour Windows
  "sample patch of how to communicate between EyeCon and Pd via OSC, Apr 13, 2005" -> Eyecon-pd-OSC.zip
 
Le cristal de Franck: crystal_glass.wav
  "Tapping on a crystal wineglass with a wooden barbecue stick. OKM binaurals, Marantz PMD671. Noise reduction."
 
helmholtz~ finds the pitch un nouvel objet Pd de Katja Vetter
 
Une citation de IOhannes m zmölnlig "I always preferred building sequencers to building sequences"
  Computer Music Journal Winter 2011 p 123
 
Sam: Pärt ou saint Gregoire ou Scelsi?
 
et... la-musique-et-les-plantes
 
 
 
 
PdTmpLab~-6 Jeudi 15 3 2012

PyRx
 
Script Python -> Patch Pd
 
 
 
 
 
PdTmpLab~-5 Jeudi 22 3 2012 dernier PdTmpLab à la Gaité Lyrique
 
 
 
"2062 LABS EN FUSION" à la Gaité Lyrique
Samedi 24 3 2012 - Dimanche 25 3 2012


2062, ALLER-RETOUR VERS LE FUTUR / 2062 : LE FINAL
 
labs_fusion.jpg
"Alors que se termine la résidence «Laboratoire Ouvert» du /tmp/lab et que débute celle de Dorkbot//Dev/art//Upgrade!, le public est invité à discuter, construire, jouer en milieu fertile et créer un espace où s'agrègent le crack, le hack, le code improvisé, la mécanique empirique du broyage de plastique et l'art de la fermentation."

Samedi 24 mars
  ...
  18H00 - 19H30 : Performance EEG, braincomputer interface (tmp/bci) //Neurohack
 
OPH_tmp-lab-gaite-lyrique Auditorium
A partir de captations des ondes électro-encéphalographiques, tmp/bci les fait voir et entendre grâce la création d'environnements visuels et sonores.
 
Dimanche 25 mars
  ...
  20H00 - 22H00 : Live Coding
 
LiveCoding Auditorium
L'ensemble philharmonique du /tmp/lab vous invite à une représentation exceptionnelle de live-coding improvisé.
Au programme : Pure Data, Super Collider, Fluxus, Processing & guest.

 
 
Retour à Vitry
 
Vitry
 
6Bis rue Leon Geffroy 94400 Vitry sur Seine http://www.tmplab.org/contact/
 
 
 
 
 
Fin de résidence / Restitution / Release à la Gaité Lyrique
Vendredi 20 4 2012 - Samedi 21 4 2012 - Dimanche 22 4 2012


/tmp/lab/ release Weekend de clôture
 
Entre ateliers et performances, le /tmp/lab/ vous donne rendez-vous une dernière fois avant de quitter les lieux, à l'issue de sa résidence d'un an.
 
Programme détaillé
 
Vendredi 20 avril 2012
  14.00- 20.00  Ateliers :
    - Usinette : Centre de Plasturgie pour Tous .
    - PROTEIN & OUT.
    - Collages électroniques.
    - Microlife par la Paillasse.
    - Exposition électronique par l’Eglise Kopimiste.
  Mezzanine :
    - 17.00 - 18.00  Concert de l’ Ensemble philharmonique.
  Petite salle :
    - 14.00 - 18.00  Psychedelight.
    - 19.00 - 20.00  In-between.
  Film à grand spectacle sur écran géant : (durée 10mn 5 fois par jour).
 
Samedi 21 avril 2012
  14.00- 20.00  Ateliers :
    - Usinette : Centre de Plasturgie pour Tous .
    - PROTEIN & OUT.
    - Collages électroniques.
    - Microlife par la Paillasse.
    - Exposition électronique par l’Eglise Kopimiste.
  Mezzanine :
    - 16.00 - 17.00  Concert de l’Ensemble philharmonique.
  Petite salle :
    - 14.00 - 18.00  Psychedelight.
    - 19.00 - 20.00  In-between.
  Film à grand spectacle sur écran géant : (durée 10mn 5 fois par jour).
 
Dimanche 22 avril 2012
  14.00- 20.00  Ateliers :
    - Usinette : Centre de Plasturgie pour Tous.
    - PROTEIN & OUT.
    - Collages électroniques.
    - Microlife par la Paillasse.
    - Exposition électronique par l’Eglise Kopimiste.
  Mezzanine :
    - 16.00 - 17.00  Concert de l’Ensemble philharmonique.
  Petite salle :
    - 14.00 - 18.00 : Psychedelight.
  Film à grand spectacle sur écran géant : (durée  10mn 5 fois par jour).
 
 
LIVE CODING DE L'ENSEMBLE PHILHARMONIQUE DU /TMP/LAB
 
LiveCoding-22-4-2012.jpg LiveCoding-22-4-2012-2.jpg
 
 
"S'inspirant de la tradition FLOSS (Free Libre Open Source Software), l’ensemble du /tmp/lab dévoile ses écrans à l'occasion d'une performance visuelle et sonore à la croisée des chemins entre écriture de code en live (live-coding), musique électronique et improvisions graphiques."
 


Chilled Out notes Blog


 
  avec Ursula, Tad, Pierre, Gérard, Milovann
  avec Accordeon, Fluxus, Perl, Pure Data, Super Collider

 
 
In Between : Performance Focus
 
eeg_focus4
 
Un ballet électronique et mécanique
"Faisceaux de lumière, vibrations sonores et micro mouvements sont travaillés par l’activité interne de deux cerveaux captée lors de la performance, pour créer un ballet électronique et mécanique des oscillations de ces ondes cérébrales."
 
InBetween-21-4-2012-1.jpg InBetween-21-4-2012-2.jpg

InBetween-21-4-2012-3.jpg
 
InBetween-21-4-2012-4.jpg
 
 
 

 
A vos hackerspaces citoyens: entretien Ursula Gastfall - Ophelia Noor - Sabine Blanc sur owni.fr
 
 
 
 
 
LogoTmpPDsur le site de Pascale     LogoTmpPDsur le site du /TMP/LAB
 
 
 
 
Toute personne dont le nom ou la photographie (permettant son identification)
apparaît sur ce site peut à tout moment demander la suppression ou la modification
des informations la concernant en contactant: gerard.paresys
 
 
page mise à jour 18 11 2013
 
Paresys Accueil Paresys Home